General Information

  • ID:  hor001964
  • Uniprot ID:  P01275
  • Protein name:  Glucagon
  • Gene name:  GCG
  • Organism:  Homo sapiens (Human)
  • Family:  Glucagon family
  • Source:  Human
  • Expression:  [Glucagon]: Release is stimulated by hypoglycemia and inhibited by hyperglycemia, insulin, and somatostatin. |[Glucagon]: Secreted in the A cells of the islets of Langerhans. [Glucagon-like peptide 2]: Secreted from enteroendocrine cells throughout the ga
  • Disease:  Diseases associated with GCG include Dumping Syndrome and Hyperglycemia.
  • Comments:  NA
  • Taxonomy:  Homo (genus), Homininae (subfamily), Hominidae (family), Hominoidea (superfamily), Catarrhini (parvorder), Simiiformes (infraorder), Haplorrhini (suborder), Primates (order), Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005102 signaling receptor binding; GO:0005179 hormone activity; GO:0005515 protein binding; GO:0031769 glucagon receptor binding; GO:0042802 identical protein binding; GO:0048018 receptor ligand activity
  • GO BP:  GO:0006094 gluconeogenesis; GO:0007186 G protein-coupled receptor signaling pathway; GO:0007188 adenylate cyclase-modulating G protein-coupled receptor signaling pathway; GO:0007189 adenylate cyclase-activating G protein-coupled receptor signaling pathway; GO:0007631 feeding behavior; GO:0010737 protein kinase A signaling; GO:0010800 positive regulation of peptidyl-threonine phosphorylation; GO:0014823 response to activity; GO:0033138 positive regulation of peptidyl-serine phosphorylation; GO:0035774 positive regulation of insulin secretion involved in cellular response to glucose stimulus; GO:0042593 glucose homeostasis; GO:0043066 negative regulation of apoptotic process; GO:0045722 positive regulation of gluconeogenesis; GO:0050796 regulation of insulin secretion; GO:0050896 response to stimulus; GO:0051571 obsolete positive regulation of histone H3-K4 methylation; GO:0070374 positive regulation of ERK1 and ERK2 cascade; GO:0071377 cellular response to glucagon stimulus; GO:0090280 positive regulation of calcium ion import; GO:1900118 negative regulation of execution phase of apoptosis
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space; GO:0005737 cytoplasm; GO:0005788 endoplasmic reticulum lumen; GO:0005886 plasma membrane; GO:0034774 secretory granule lumen

Sequence Information

  • Sequence:  HSQGTFTSDYSKYLDSRRAQDFVQWLMNT
  • Length:  29
  • Propeptide:  MKSIYFVAGLFVMLVQGSWQRSLQDTEEKSRSFSASQADPLSDPDQMNEDKRHSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIAKRHDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGRGRRDFPEEVAIVEELGRRHADGSFSDEMNTILDNLAARDFINWLIQTKITDRK
  • Signal peptide:  MKSIYFVAGLFVMLVQGSWQ
  • Modification:  T2 Phosphoserine
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Glucagon plays a key role in glucose metabolism and homeostasis. Regulates blood glucose by increasing gluconeogenesis and decreasing glycolysis. A counterregulatory hormone of insulin, raises plasma glucose levels in response to insulin-induced hypoglycemia. Plays an important role in initiating and maintaining hyperglycemic conditions in diabetes.
  • Mechanism:  In the glucagon antagonist, His-53 and Phe-58 are missing. This antagonist has been successfully utilized to reduce glucose concentration in vivo.
  • Cross BBB:  NA
  • Target:  GCGR
  • Target Unid:  P47871
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: <10 minutes; /600 seconds ( PubMed ID: 20418955 )

Structure

  • Disulfide bond:  NA
  • Structure ID:  NA

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor001964_AF2.pdbhor001964_ESM.pdb

Physical Information

Mass: 398239 Formula: C153H225N43O49S
Absent amino acids: CEIP Common amino acids: S
pI: 7.54 Basic residues: 4
Polar residues: 11 Hydrophobic residues: 7
Hydrophobicity: -98.97 Boman Index: -8379
Half-Life: 3.5 hour Half-Life Yeast: 10 min
Half-Life E.Coli: >10 hour Aliphatic Index 40.34
Instability Index: 5602.76 Extinction Coefficient cystines: 8480
Absorbance 280nm: 302.86

Literature